PDB entry 6fd1

View 6fd1 on RCSB PDB site
Description: 7-fe ferredoxin from azotobacter vinelandii low temperature, 1.35 a
Deposited on 1997-09-17, released 1997-11-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.15
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d6fd1__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6fd1_ (-)
  afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler