Lineage for d6v2fd1 (6v2f D:1-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717894Domain d6v2fd1: 6v2f D:1-147 [388671]
    Other proteins in same PDB: d6v2fa2, d6v2fb2, d6v2fc2, d6v2fd2, d6v2fe2, d6v2ff2
    automated match to d4xfxa1
    complexed with qng

Details for d6v2fd1

PDB Entry: 6v2f (more details), 2 Å

PDB Description: crystal structure of the hiv capsid hexamer bound to the small molecule long-acting inhibitor, gs-6207
PDB Compounds: (D:) hiv-1 capsid

SCOPe Domain Sequences for d6v2fd1:

Sequence, based on SEQRES records: (download)

>d6v2fd1 a.73.1.1 (D:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d6v2fd1 a.73.1.1 (D:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghqaam
qmlketineeaaewdrlhpapgqmreprgsdiagttstlqeqigwmthnppipvgeiykr
wiilglnkivrmysp

SCOPe Domain Coordinates for d6v2fd1:

Click to download the PDB-style file with coordinates for d6v2fd1.
(The format of our PDB-style files is described here.)

Timeline for d6v2fd1: