SCOPe 2.08: Domain d6v2fb2: 6v2f B:148-219

Lineage for d6v2fb2 (6v2f B:148-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)

8. Domain d6v2fb2: 6v2f B:148-219 [388668]
   Other proteins in same PDB: d6v2fa1, d6v2fb1, d6v2fc1, d6v2fd1, d6v2fe1, d6v2ff1
   automated match to d2m8pa2
   complexed with qng

Details for d6v2fb2

PDB Entry: 6v2f, 2 Å

PDB Description: crystal structure of the hiv capsid hexamer bound to the small molecule long-acting inhibitor, gs-6207

PDB Compounds: (B:) hiv-1 capsid

SCOPe Domain Sequences for d6v2fb2:

Sequence, based on SEQRES records:

>d6v2fb2 a.28.3.0 (B:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records):

>d6v2fb2 a.28.3.0 (B:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraetllvqnanpdcktilkalgpgatleemmtacq

Timeline for d6v2fb2:

• d6v2fb2 first appeared in SCOPe 2.07