Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Escherichia coli [TaxId:562] [388137] (2 PDB entries) |
Domain d6oqrf3: 6oqr F:344-459 [388252] Other proteins in same PDB: d6oqrd1, d6oqrd2, d6oqre1, d6oqre2, d6oqrf1, d6oqrf2, d6oqrg_, d6oqrh1, d6oqrh2, d6oqri_, d6oqrj_, d6oqrl_, d6oqrm_, d6oqrn_, d6oqro_, d6oqrp_, d6oqrq_, d6oqrr_, d6oqrs_ automated match to d4q4la3 complexed with adp, atp, mg, po4 |
PDB Entry: 6oqr (more details), 3.1 Å
SCOPe Domain Sequences for d6oqrf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oqrf3 a.69.1.0 (F:344-459) automated matches {Escherichia coli [TaxId: 562]} ldplvvgqehydtargvqsilqryqelkdiiailgmdelseedklvvararkiqrflsqp ffvaevftgspgkyvslkdtirgfkgimegeydhlpeqafymvgsieeavekakkl
Timeline for d6oqrf3: