SCOPe 2.07: Domain d6oqrf3: 6oqr F:344-459

Lineage for d6oqrf3 (6oqr F:344-459)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [388137] (2 PDB entries)

8. Domain d6oqrf3: 6oqr F:344-459 [388252]
   Other proteins in same PDB: d6oqrd1, d6oqrd2, d6oqre1, d6oqre2, d6oqrf1, d6oqrf2, d6oqrg_, d6oqrh1, d6oqrh2, d6oqri_, d6oqrj_, d6oqrl_, d6oqrm_, d6oqrn_, d6oqro_, d6oqrp_, d6oqrq_, d6oqrr_, d6oqrs_
   automated match to d4q4la3
   complexed with adp, atp, mg, po4

Details for d6oqrf3

PDB Entry: 6oqr, 3.1 Å

PDB Description: e. coli atp synthase adp state 1a

PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d6oqrf3:

Sequence; same for both SEQRES and ATOM records:

>d6oqrf3 a.69.1.0 (F:344-459) automated matches {Escherichia coli [TaxId: 562]}
ldplvvgqehydtargvqsilqryqelkdiiailgmdelseedklvvararkiqrflsqp
ffvaevftgspgkyvslkdtirgfkgimegeydhlpeqafymvgsieeavekakkl

Timeline for d6oqrf3:

• d6oqrf3 is new in SCOPe 2.07-stable
  
• d6oqrf3 appears in the current release, SCOPe 2.08