SCOPe 2.07: Structural Classification of Proteins

PDB entry 6oqr

View 6oqr on RCSB PDB site
Description: E. coli ATP Synthase ADP State 1a
Class: membrane protein
Keywords: E coli ATP Synthase, ion channel, ATPase, MEMBRANE PROTEIN
Deposited on 2019-04-29, released 2020-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-24, with a file datestamp of 2020-06-19.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ATP synthase subunit alpha
Species: Escherichia coli [TaxId:562]
Gene: atpA, AD31_4476
Database cross-references and differences (RAF-indexed):
- Uniprot A0A073FQ32
Chain 'B':
Compound: ATP synthase subunit alpha
Species: Escherichia coli [TaxId:562]
Gene: atpA, AD31_4476
Database cross-references and differences (RAF-indexed):
- Uniprot A0A073FQ32 (0-End)
Chain 'C':
Compound: ATP synthase subunit alpha
Species: Escherichia coli [TaxId:562]
Gene: atpA, AD31_4476
Database cross-references and differences (RAF-indexed):
- Uniprot A0A073FQ32 (Start-512)
Chain 'D':
Compound: ATP synthase subunit beta
Species: Escherichia coli [TaxId:562]
Gene: atpD, WLH_03015
Database cross-references and differences (RAF-indexed):
- Uniprot A0A192CEZ8 (11-470)
  - conflict (148)
Domains in SCOPe 2.07: d6oqrd1, d6oqrd2, d6oqrd3
Chain 'E':
Compound: ATP synthase subunit beta
Species: Escherichia coli [TaxId:562]
Gene: atpD, WLH_03015
Database cross-references and differences (RAF-indexed):
- Uniprot A0A192CEZ8 (11-470)
  - conflict (148)
Domains in SCOPe 2.07: d6oqre1, d6oqre2, d6oqre3
Chain 'F':
Compound: ATP synthase subunit beta
Species: Escherichia coli [TaxId:562]
Gene: atpD, WLH_03015
Database cross-references and differences (RAF-indexed):
- Uniprot A0A192CEZ8 (Start-470)
  - conflict (148)
Domains in SCOPe 2.07: d6oqrf1, d6oqrf2, d6oqrf3
Chain 'G':
Compound: ATP synthase gamma chain
Species: Escherichia coli [TaxId:562]
Gene: atpG, BN16_43751
Database cross-references and differences (RAF-indexed):
- Uniprot J7RYJ3
  - conflict (87)
  - conflict (112)
Domains in SCOPe 2.07: d6oqrg_
Chain 'H':
Compound: ATP synthase epsilon chain
Species: Escherichia coli [TaxId:562]
Gene: atpC, A1WS_04460
Database cross-references and differences (RAF-indexed):
- Uniprot S1HQ43 (Start-138)
Domains in SCOPe 2.07: d6oqrh1, d6oqrh2
Chain 'I':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqri_
Chain 'J':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqrj_
Chain 'L':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqrl_
Chain 'M':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqrm_
Chain 'N':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqrn_
Chain 'O':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqro_
Chain 'P':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqrp_
Chain 'Q':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqrq_
Chain 'R':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55
Domains in SCOPe 2.07: d6oqrr_
Chain 'S':
Compound: ATP synthase subunit c
Species: Escherichia coli [TaxId:562]
Gene: atpE, ECJG_03465
Database cross-references and differences (RAF-indexed):
- Uniprot F4TL55 (Start-78)
Domains in SCOPe 2.07: d6oqrs_
Chain 'W':
Compound: ATP synthase subunit delta
Species: Escherichia coli [TaxId:562]
Gene: atpH, AB67_4411
Database cross-references and differences (RAF-indexed):
- Uniprot A0A073H3T8
  - conflict (64)
  - conflict (140)
Chain 'X':
Compound: ATP synthase subunit b
Species: Escherichia coli [TaxId:562]
Gene: atpF, ECDG_04362
Database cross-references and differences (RAF-indexed):
- Uniprot D6IFY0 (0-155)
Chain 'Y':
Compound: ATP synthase subunit b
Species: Escherichia coli [TaxId:562]
Gene: atpF, ECDG_04362
Database cross-references and differences (RAF-indexed):
- Uniprot D6IFY0 (0-155)
Chain 'a':
Compound: ATP synthase subunit a
Species: Escherichia coli [TaxId:562]
Gene: atpB, A6581_09625, A8C65_04635, A8G17_13205, A9819_21465, AC789_1c41260, ACN002_3840, ACN77_20010, ACN81_06510, ACU57_03300, ACU90_00315, AKG99_01200, AM464_11965, AMK83_17435, AML07_02005, AML35_23925, APZ14_19970, AU473_02230, AUQ13_19445, AUS26_01135, AW059_18665, AW106_23235, B1K96_28785, B7C53_19560, BANRA_02401, BANRA_03128, BANRA_03214, BANRA_04536, BANRA_04611, BB545_21600, BHF46_03220, BHS81_22305, BIZ41_19310, BK292_20055, BK400_00980, BMT53_14990, BMT91_10650, BN17_36921, BTQ04_25560, BTQ06_19305, BUE81_18230, BVL39_06790, BW690_12705, BWP17_17405, BZL31_21415, C2U48_14255, C4J69_12205, C5N07_23075, C5P01_14375, C5P43_18495, C5P44_14015, C6669_08960, C7235_25075, C7B02_15545, C7B06_18115, C7B07_18555, CA593_07300, CG691_14695, CG692_21460, CG705_13230, CG706_05505, COD30_14545, COD46_05110, CR538_25535, CR539_00375, CRD98_06365, CRE06_22220, CRM83_19985, CV83915_02325, CVH05_22810, CWS33_22485, D0X26_21590, D2F89_18645, D3821_26125, D3I61_22220, D6Z21_17295, D7K63_14130, D8K42_12760, D9D20_15080, D9D23_18435, D9D65_17115, D9D69_04800, D9D77_23770, D9E35_19420, D9F57_04785, D9G42_23250, D9H12_19550, D9H53_20710, D9H66_14770, D9H68_12120, D9H70_07975, D9H84_13135, D9I18_08055, D9I52_22315, D9I93_11990, D9J11_15870, D9J44_15620, D9J48_14640, D9K10_12565, DIV22_14605, DL800_26315, DL925_10465, DLU27_05670, DM262_10125, DMI41_02740, DNQ45_04220, DOT75_06920, DP258_23940, DP277_10610, DQF57_16240, DS732_00235, DTL43_15450, DTL90_16085, DV750_19840, E2855_04743, EAI42_11905, EAI44_10320, EAI52_06435, EB510_22250, EB553_22600, EB569_11805, EB595_21530, EC1094V2_4559, EC3234A_68c00800, EC95NR1_03180, ECs4680, ED060_20795, ED098_20360, ED124_20405, ED133_14365, ED287_08070, ED600_20035, ED648_17305, ED653_18700, ED658_09750, ED944_14625, EEP03_14120, EEP23_14845, EF364_23525, EFV06_19295, EIA21_14165, EL75_4432, EL79_4683, EL80_4591, ERS085374_04660, ERS085379_02386, ERS085383_02615, ERS085386_04244, ERS085404_04407, ERS150876_04315, FORC28_6046, GJ11_23870, HW43_00205, JD73_04915, NCTC10090_03054, NCTC10418_07533, NCTC10429_00459, NCTC10444_05020, NCTC11022_03985, NCTC11126_01888, NCTC11181_02279, NCTC13125_03147, NCTC13127_06463, NCTC13462_03577, NCTC7152_05030, NCTC8179_05398, NCTC8622_01220, NCTC8960_02611, NCTC9036_04909, NCTC9037_05079, NCTC9045_05855, NCTC9054_05546, NCTC9055_01929, NCTC9058_01885, NCTC9062_03146, NCTC9073_06659, NCTC9111_05225, NCTC9117_06282, NCTC9119_05322, NCTC9701_05266, NCTC9703_04488, NCTC9706_02267, NCTC9969_05235, PU06_21025, RG28_23995, RK56_018685, RX35_03591, SAMEA3472044_00548, SAMEA3472047_02992, SAMEA3472055_04839, SAMEA3472056_03685, SAMEA3472067_04030, SAMEA3472070_05212, SAMEA3472080_03392, SAMEA3472108_02423, SAMEA3472114_05011, SAMEA3472147_03706, SAMEA3484427_03569, SAMEA3484429_03570, SAMEA3484433_04143, SAMEA3485101_04107, SAMEA3752557_01245, SAMEA3752559_04742, SAMEA3753064_05400, SAMEA3753097_00985, SAMEA3753290_05396, SAMEA3753300_04372, SAMEA3753397_02464, SK85_04068, UN86_05680, UN91_09915, WQ89_11300, WR15_16550
Database cross-references and differences (RAF-indexed):
- Uniprot C3SL77
Heterogens: ATP, MG, ADP, PO4

PDB Chain Sequences:

Chain 'A':
No sequence available.
Chain 'B':
No sequence available.
Chain 'C':
No sequence available.

Chain 'D':
Sequence, based on SEQRES records: (download)

>6oqrD (D:)
mrgshhhhhhgmatgkivqvigavvdvefpqdavprvydalevqngnerlvlevqqqlgg
givrtiamgssdglrrgldvkdlehpievpvgkatlgrimnvlgepvdmkgeigeeerwa
ihraapsyeelsnsqelletgikvidlmapfakggkvglfggagvgktvnmmelirniai
ehsgysvfagvgertregndfyhemtdsnvidkvslvygqmneppgnrlrvaltgltmae
kfrdegrdvllfvdniyrytlagtevsallgrmpsavgyqptlaeemgvlqeritstktg
sitsvqavyvpaddltdpspattfahldatvvlsrqiaslgiypavdpldstsrqldplv
vgqehydtargvqsilqryqelkdiiailgmdelseedklvvararkiqrflsqpffvae
vftgspgkyvslkdtirgfkgimegeydhlpeqafymvgsieeavekakkl