Lineage for d6oqrn_ (6oqr N:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629298Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) (S)
    automatically mapped to Pfam PF00137
  5. 2629299Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins)
  6. 2629339Protein automated matches [367200] (3 species)
    not a true protein
  7. 2629340Species Escherichia coli [TaxId:562] [386971] (4 PDB entries)
  8. 2629375Domain d6oqrn_: 6oqr N: [388206]
    Other proteins in same PDB: d6oqrd1, d6oqrd2, d6oqrd3, d6oqre1, d6oqre2, d6oqre3, d6oqrf1, d6oqrf2, d6oqrf3, d6oqrg_, d6oqrh1, d6oqrh2
    automated match to d1l6ta_
    complexed with adp, atp, mg, po4

Details for d6oqrn_

PDB Entry: 6oqr (more details), 3.1 Å

PDB Description: e. coli atp synthase adp state 1a
PDB Compounds: (N:) ATP synthase subunit c

SCOPe Domain Sequences for d6oqrn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oqrn_ f.17.1.1 (N:) automated matches {Escherichia coli [TaxId: 562]}
nlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglvda
ipmiavglglyvmfava

SCOPe Domain Coordinates for d6oqrn_:

Click to download the PDB-style file with coordinates for d6oqrn_.
(The format of our PDB-style files is described here.)

Timeline for d6oqrn_: