Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
Superfamily d.45.1: ClpS-like [54736] (2 families) |
Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein) |
Protein Ribosomal protein L7/12, C-terminal domain [54738] (2 species) |
Species Thermotoga maritima [TaxId:243274] [54740] (2 PDB entries) |
Domain d1dd3a2: 1dd3 A:58-128 [38760] Other proteins in same PDB: d1dd3a1, d1dd3b1, d1dd3c_, d1dd3d_ |
PDB Entry: 1dd3 (more details), 2 Å
SCOP Domain Sequences for d1dd3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dd3a2 d.45.1.1 (A:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima} efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk leeagaevelk
Timeline for d1dd3a2:
View in 3D Domains from other chains: (mouse over for more information) d1dd3b1, d1dd3b2, d1dd3c_, d1dd3d_ |