Lineage for d1dd3a2 (1dd3 A:58-128)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32058Fold d.45: Ribosomal protein L7/12, C-terminal domain [54735] (1 superfamily)
  4. 32059Superfamily d.45.1: Ribosomal protein L7/12, C-terminal domain [54736] (1 family) (S)
  5. 32060Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)
  6. 32061Protein Ribosomal protein L7/12, C-terminal domain [54738] (2 species)
  7. Species Thermotoga maritima [TaxId:243274] [54740] (2 PDB entries)
  8. Domain d1dd3a2: 1dd3 A:58-128 [38760]
    Other proteins in same PDB: d1dd3a1, d1dd3b1, d1dd3c1, d1dd3d1

Details for d1dd3a2

PDB Entry: 1dd3 (more details), 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima

SCOP Domain Sequences for d1dd3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd3a2 d.45.1.1 (A:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

SCOP Domain Coordinates for d1dd3a2 are not available.

Timeline for d1dd3a2:

Domains from same chain:
(mouse over for more information)
d1dd3a1
Domains from other chains:
(mouse over for more information)
d1dd3b1, d1dd3b2, d1dd3c1, d1dd3d1