Lineage for d1dd3b1 (1dd3 B:1-57)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216807Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 216808Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 216809Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 216810Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (1 species)
  7. 216811Species Thermotoga maritima [TaxId:243274] [48303] (2 PDB entries)
  8. 216813Domain d1dd3b1: 1dd3 B:1-57 [19032]
    Other proteins in same PDB: d1dd3a2, d1dd3b2

Details for d1dd3b1

PDB Entry: 1dd3 (more details), 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima

SCOP Domain Sequences for d1dd3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd3b1 a.108.1.1 (B:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

SCOP Domain Coordinates for d1dd3b1:

Click to download the PDB-style file with coordinates for d1dd3b1.
(The format of our PDB-style files is described here.)

Timeline for d1dd3b1: