SCOPe 2.08: Domain d6wwdb_: 6wwd B:

Lineage for d6wwdb_ (6wwd B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (9 species)
   not a true protein

7. Species Mycobacteroides abscessus [TaxId:561007] [385953] (1 PDB entry)

8. Domain d6wwdb_: 6wwd B: [385955]
   automated match to d3tqua_

Details for d6wwdb_

PDB Entry: 6wwd, 2.1 Å

PDB Description: crystal structure of nucleoside-triphosphatase / ditp/xtp pyrophosphatase from mycobacterium abscessus atcc 19977 / dsm 44196

PDB Compounds: (B:) dITP/XTP pyrophosphatase

SCOPe Domain Sequences for d6wwdb_:

Sequence, based on SEQRES records:

>d6wwdb_ c.51.4.0 (B:) automated matches {Mycobacteroides abscessus [TaxId: 561007]}
mkilvasrnpkklaelsrvlessgvsgvelvsltdvpeyeevpetgasfednalikareg
vkhtglacvaddsglavdalnwmpgvlsarwsgrhgddaantalllaqlsdipderrgaa
fvsacalvtpegeevvvegrwkgsiaripagqngfgydpifvprgglrtaaeltpeekda
vshrgralaallpm

Sequence, based on observed residues (ATOM records):

>d6wwdb_ c.51.4.0 (B:) automated matches {Mycobacteroides abscessus [TaxId: 561007]}
mkilvasrnpkklaelsrvlesgvelvsltdvpeyeevpetgasfednalikaregvkht
glacvaddsglavdalnwmpgvlsarwsgrhgddaantalllaqlsdipderrgaafvsa
calvtpegeevvvegrwkgsiaripagqngfgydpifvprgglrtaaeltpeekdavshr
gralaallpm

Timeline for d6wwdb_:

• d6wwdb_ first appeared in SCOPe 2.07