Lineage for d6wwdb_ (6wwd B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2490017Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2490079Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 2490080Protein automated matches [190179] (9 species)
    not a true protein
  7. 2490121Species Mycobacteroides abscessus [TaxId:561007] [385953] (1 PDB entry)
  8. 2490123Domain d6wwdb_: 6wwd B: [385955]
    automated match to d3tqua_

Details for d6wwdb_

PDB Entry: 6wwd (more details), 2.1 Å

PDB Description: crystal structure of nucleoside-triphosphatase / ditp/xtp pyrophosphatase from mycobacterium abscessus atcc 19977 / dsm 44196
PDB Compounds: (B:) dITP/XTP pyrophosphatase

SCOPe Domain Sequences for d6wwdb_:

Sequence, based on SEQRES records: (download)

>d6wwdb_ c.51.4.0 (B:) automated matches {Mycobacteroides abscessus [TaxId: 561007]}
mkilvasrnpkklaelsrvlessgvsgvelvsltdvpeyeevpetgasfednalikareg
vkhtglacvaddsglavdalnwmpgvlsarwsgrhgddaantalllaqlsdipderrgaa
fvsacalvtpegeevvvegrwkgsiaripagqngfgydpifvprgglrtaaeltpeekda
vshrgralaallpm

Sequence, based on observed residues (ATOM records): (download)

>d6wwdb_ c.51.4.0 (B:) automated matches {Mycobacteroides abscessus [TaxId: 561007]}
mkilvasrnpkklaelsrvlesgvelvsltdvpeyeevpetgasfednalikaregvkht
glacvaddsglavdalnwmpgvlsarwsgrhgddaantalllaqlsdipderrgaafvsa
calvtpegeevvvegrwkgsiaripagqngfgydpifvprgglrtaaeltpeekdavshr
gralaallpm

SCOPe Domain Coordinates for d6wwdb_:

Click to download the PDB-style file with coordinates for d6wwdb_.
(The format of our PDB-style files is described here.)

Timeline for d6wwdb_: