Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (9 species) not a true protein |
Species Mycobacteroides abscessus [TaxId:561007] [385953] (1 PDB entry) |
Domain d6wwdb_: 6wwd B: [385955] automated match to d3tqua_ |
PDB Entry: 6wwd (more details), 2.1 Å
SCOPe Domain Sequences for d6wwdb_:
Sequence, based on SEQRES records: (download)
>d6wwdb_ c.51.4.0 (B:) automated matches {Mycobacteroides abscessus [TaxId: 561007]} mkilvasrnpkklaelsrvlessgvsgvelvsltdvpeyeevpetgasfednalikareg vkhtglacvaddsglavdalnwmpgvlsarwsgrhgddaantalllaqlsdipderrgaa fvsacalvtpegeevvvegrwkgsiaripagqngfgydpifvprgglrtaaeltpeekda vshrgralaallpm
>d6wwdb_ c.51.4.0 (B:) automated matches {Mycobacteroides abscessus [TaxId: 561007]} mkilvasrnpkklaelsrvlesgvelvsltdvpeyeevpetgasfednalikaregvkht glacvaddsglavdalnwmpgvlsarwsgrhgddaantalllaqlsdipderrgaafvsa calvtpegeevvvegrwkgsiaripagqngfgydpifvprgglrtaaeltpeekdavshr gralaallpm
Timeline for d6wwdb_: