Lineage for d6jzvc_ (6jzv C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007715Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)
  6. 3007730Protein automated matches [254586] (5 species)
    not a true protein
  7. 3007731Species Bacillus subtilis [TaxId:224308] [343280] (3 PDB entries)
  8. 3007734Domain d6jzvc_: 6jzv C: [385009]
    automated match to d1xjsa_
    complexed with zn

Details for d6jzvc_

PDB Entry: 6jzv (more details), 2 Å

PDB Description: crystal structure of sufu from bacillus subtilis
PDB Compounds: (C:) Zinc-dependent sulfurtransferase SufU

SCOPe Domain Sequences for d6jzvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jzvc_ d.224.1.2 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
sfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakf
egegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvsk
fparikcatlswkalekgv

SCOPe Domain Coordinates for d6jzvc_:

Click to download the PDB-style file with coordinates for d6jzvc_.
(The format of our PDB-style files is described here.)

Timeline for d6jzvc_: