Lineage for d1xjsa_ (1xjs A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007715Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)
  6. 3007722Protein NifU [117910] (1 species)
  7. 3007723Species Bacillus subtilis [TaxId:1423] [117911] (2 PDB entries)
    Uniprot O32163
  8. 3007724Domain d1xjsa_: 1xjs A: [115392]
    Structural genomics target
    complexed with zn

Details for d1xjsa_

PDB Entry: 1xjs (more details)

PDB Description: solution structure of iron-sulfur cluster assembly protein iscu from bacillus subtilis, with zinc bound at the active site. northeast structural genomics consortium target sr17
PDB Compounds: (A:) NifU-like protein

SCOPe Domain Sequences for d1xjsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjsa_ d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 1423]}
msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
kfparikcatlswkalekgvakeeggn

SCOPe Domain Coordinates for d1xjsa_:

Click to download the PDB-style file with coordinates for d1xjsa_.
(The format of our PDB-style files is described here.)

Timeline for d1xjsa_: