SCOPe 2.08: Domain d6va5a2: 6va5 A:1538-1606

Lineage for d6va5a2 (6va5 A:1538-1606)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species)
   protein duplication: contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d6va5a2: 6va5 A:1538-1606 [384853]
   Other proteins in same PDB: d6va5a1
   automated match to d1ssfa2
   complexed with gol, qss, so4, unx

Details for d6va5a2

PDB Entry: 6va5, 1.28 Å

PDB Description: tudor domain of tumor suppressor p53bp1 with mfp-4184

PDB Compounds: (A:) TP53-binding protein 1

SCOPe Domain Sequences for d6va5a2:

Sequence; same for both SEQRES and ATOM records:

>d6va5a2 b.34.9.1 (A:1538-1606) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglgpye

Timeline for d6va5a2:

• d6va5a2 first appeared in SCOPe 2.07