Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (1 species) |
Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries) |
Domain d1hnwp_: 1hnw P: [38447] Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_ complexed with mg, tac, zn |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnwp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqearega
Timeline for d1hnwp_: