Lineage for d1hnwp_ (1hnw P:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31571Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
  4. 31572Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 31573Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 31574Protein Ribosomal protein S16 [54567] (1 species)
  7. 31575Species Thermus thermophilus [TaxId:274] [54568] (7 PDB entries)
  8. 31580Domain d1hnwp_: 1hnw P: [38447]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwp_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

SCOP Domain Coordinates for d1hnwp_:

Click to download the PDB-style file with coordinates for d1hnwp_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwp_: