SCOPe 2.07: Domain d6laha1: 6lah A:0-181

Lineage for d6laha1 (6lah A:0-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Macaca mulatta [TaxId:9544] [384001] (4 PDB entries)

8. Domain d6laha1: 6lah A:0-181 [384002]
   Other proteins in same PDB: d6laha2, d6lahb_, d6lahc2, d6lahd_
   automated match to d1xh3a2
   complexed with edo, ekg, zn

Details for d6laha1

PDB Entry: 6lah, 1.87 Å

PDB Description: crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with lysophosphatidylcholine

PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d6laha1:

Sequence; same for both SEQRES and ATOM records:

>d6laha1 d.19.1.1 (A:0-181) automated matches {Macaca mulatta [TaxId: 9544]}
agshsmryfsttvsrpgrgeprfivvgyvddtqfvrfdsdaaspkmeprapwmeqegpey
weeqtrrvkdaaqtfrvslgnlrgyynqseagshtlqtmsgcdlgpdgrllrgyyqqayd
grdyialnedlrswtaadeaaqntqrkweaagvaeqwraylegecleslrrylengketl
qr

Timeline for d6laha1:

• d6laha1 is new in SCOPe 2.07-stable
  
• d6laha1 appears in the current release, SCOPe 2.08