![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species) |
![]() | Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries) |
![]() | Domain d1ggxc_: 1ggx C: [38369] |
PDB Entry: 1ggx (more details), 1.9 Å
SCOPe Domain Sequences for d1ggxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggxc_ d.22.1.1 (C:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]} vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp vqlpgyyyvdsklditshnedytiveqyertegrhhlfl
Timeline for d1ggxc_: