Lineage for d1ggxb_ (1ggx B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899128Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 1899129Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)
  8. 1899131Domain d1ggxb_: 1ggx B: [38368]

Details for d1ggxb_

PDB Entry: 1ggx (more details), 1.9 Å

PDB Description: red fluorescent protein (fp583 or dsred(clontech)) from discosoma sp.
PDB Compounds: (B:) protein (fluorescent protein fp583)

SCOPe Domain Sequences for d1ggxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggxb_ d.22.1.1 (B:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d1ggxb_:

Click to download the PDB-style file with coordinates for d1ggxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ggxb_: