Lineage for d6snpa3 (6snp A:323-439)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910221Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2910222Protein automated matches [254721] (4 species)
    not a true protein
  7. 2910230Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries)
  8. 2910305Domain d6snpa3: 6snp A:323-439 [383448]
    Other proteins in same PDB: d6snpa4
    automated match to d5jn5a3
    complexed with mg

Details for d6snpa3

PDB Entry: 6snp (more details), 2.75 Å

PDB Description: crystal structures of human pgm1 isoform 2
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d6snpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6snpa3 c.84.1.0 (A:323-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwkffgn
lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqkyg

SCOPe Domain Coordinates for d6snpa3:

Click to download the PDB-style file with coordinates for d6snpa3.
(The format of our PDB-style files is described here.)

Timeline for d6snpa3: