Lineage for d6kwyd_ (6kwy D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990749Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries)
  8. 2990781Domain d6kwyd_: 6kwy D: [382982]
    Other proteins in same PDB: d6kwyb_, d6kwyh_, d6kwyi_, d6kwyj_, d6kwyk_, d6kwyl_, d6kwym_, d6kwyn_, d6kwyv_, d6kwyw_, d6kwyx_, d6kwyy_, d6kwyz_
    automated match to d6reye_
    complexed with ihp, k0w

Details for d6kwyd_

PDB Entry: 6kwy (more details), 2.72 Å

PDB Description: human pa200-20s complex
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6kwyd_:

Sequence, based on SEQRES records: (download)

>d6kwyd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
i

Sequence, based on observed residues (ATOM records): (download)

>d6kwyd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
lpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhksmtlkea
ikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi

SCOPe Domain Coordinates for d6kwyd_:

Click to download the PDB-style file with coordinates for d6kwyd_.
(The format of our PDB-style files is described here.)

Timeline for d6kwyd_: