| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
| Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141512] (46 PDB entries) Uniprot P30405 44-207 |
| Domain d6y3ea_: 6y3e A: [382028] automated match to d2x2aa_ complexed with 12p, edo, na, po4 |
PDB Entry: 6y3e (more details), 1.45 Å
SCOPe Domain Sequences for d6y3ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y3ea_ b.62.1.1 (A:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls
Timeline for d6y3ea_: