Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species) |
Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [54463] (5 PDB entries) |
Domain d1d6ea2: 1d6e A:4-81 [38195] Other proteins in same PDB: d1d6ea1, d1d6eb1, d1d6ec1, d1d6ec2 |
PDB Entry: 1d6e (more details), 2.45 Å
SCOP Domain Sequences for d1d6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6ea2 d.19.1.1 (A:4-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d1d6ea2:
View in 3D Domains from other chains: (mouse over for more information) d1d6eb1, d1d6eb2, d1d6ec1, d1d6ec2 |