Lineage for d1d6ea2 (1d6e A:4-81)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [54463] (4 PDB entries)
  8. 31334Domain d1d6ea2: 1d6e A:4-81 [38195]
    Other proteins in same PDB: d1d6ea1, d1d6eb1, d1d6ec1, d1d6ec2

Details for d1d6ea2

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ea2 d.19.1.1 (A:4-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOP Domain Coordinates for d1d6ea2:

Click to download the PDB-style file with coordinates for d1d6ea2.
(The format of our PDB-style files is described here.)

Timeline for d1d6ea2: