Lineage for d1d6ea2 (1d6e A:4-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938289Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88811] (5 PDB entries)
  8. 2938292Domain d1d6ea2: 1d6e A:4-81 [38195]
    Other proteins in same PDB: d1d6ea1, d1d6eb1, d1d6eb2, d1d6ec1, d1d6ec2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1d6ea2

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb
PDB Compounds: (A:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1d6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ea2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d1d6ea2:

Click to download the PDB-style file with coordinates for d1d6ea2.
(The format of our PDB-style files is described here.)

Timeline for d1d6ea2: