Lineage for d1hqra2 (1hqr A:3-81)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. 31315Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries)
  8. Domain d1hqra2: 1hqr A:3-81 [38187]
    Other proteins in same PDB: d1hqra1, d1hqrb1, d1hqrd1, d1hqrd2

Details for d1hqra2

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqra2 d.19.1.1 (A:3-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1hqra2 are not available.

Timeline for d1hqra2:

Domains from same chain:
(mouse over for more information)
d1hqra1
Domains from other chains:
(mouse over for more information)
d1hqrb1, d1hqrb2, d1hqrd1, d1hqrd2