Lineage for d1hqrd1 (1hqr D:503-595)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins) 
Protein Streptococcal superantigen Spe-C [50232] (1 species) Species Streptococcus pyogenes [TaxId:1314] [50233] (2 PDB entries) - Domain d1hqrd1: 1hqr D:503-595 [25203]
Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrb2, d1hqrd2
Details for d1hqrd1
PDB Entry: 1hqr (more details), 3.2 Å
PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
SCOP Domain Sequences for d1hqrd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqrd1 b.40.2.2 (D:503-595) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn
SCOP Domain Coordinates for d1hqrd1 are not available.
Timeline for d1hqrd1:
- d1hqrd1 appears in SCOP 1.57
- d1hqrd1 appears in the current release, SCOPe 2.08