![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries) |
PDB Entry: 1hqr (more details), 3.2 Å
SCOP Domain Sequences for d1hqrb1:
Sequence, based on SEQRES records: (download)
>d1hqrb1 b.1.1.2 (B:293-390) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
>d1hqrb1 b.1.1.2 (B:293-390) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} rrvepkvtvypahnllvcsvngfypgsievrwfrnsqeekagvvstgliqngdwtfqtlv mletvprevytcqvehpsvtspltvewra
Timeline for d1hqrb1: