Lineage for d1hqrb1 (1hqr B:293-390)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. 8399Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries)
  8. Domain d1hqrb1: 1hqr B:293-390 [21614]
    Other proteins in same PDB: d1hqra2, d1hqrb2, d1hqrd1, d1hqrd2

Details for d1hqrb1

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqrb1:

Sequence, based on SEQRES records: (download)

>d1hqrb1 b.1.1.2 (B:293-390) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1hqrb1 b.1.1.2 (B:293-390) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
rrvepkvtvypahnllvcsvngfypgsievrwfrnsqeekagvvstgliqngdwtfqtlv
mletvprevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1hqrb1 are not available.

Timeline for d1hqrb1:

Domains from same chain:
(mouse over for more information)
d1hqrb2
Domains from other chains:
(mouse over for more information)
d1hqra1, d1hqra2, d1hqrd1, d1hqrd2