Lineage for d6ntcb_ (6ntc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932904Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2932911Protein c-Raf1 RBD [54264] (2 species)
  7. 2932912Species Human (Homo sapiens) [TaxId:9606] [54265] (8 PDB entries)
  8. 2932918Domain d6ntcb_: 6ntc B: [381723]
    Other proteins in same PDB: d6ntca1, d6ntca2
    automated match to d4g0nb_
    complexed with gnp, gol, mg

Details for d6ntcb_

PDB Entry: 6ntc (more details), 2.9 Å

PDB Description: crystal structure of g12v hras-gppnhp bound in complex with the engineered rbd variant 1 of craf kinase protein
PDB Compounds: (B:) raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d6ntcb_:

Sequence, based on SEQRES records: (download)

>d6ntcb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]}
ntirvllpnqewtvvkvrngmslhdslmkalkrhglqpessavfrllhehkgkkarldwn
tdaasligeelqvdf

Sequence, based on observed residues (ATOM records): (download)

>d6ntcb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]}
ntirvllpnqewtvvkvmslhdslmkalkrhglqpessavfkarldwntdaasligeelq
vdf

SCOPe Domain Coordinates for d6ntcb_:

Click to download the PDB-style file with coordinates for d6ntcb_.
(The format of our PDB-style files is described here.)

Timeline for d6ntcb_: