Lineage for d1eqka_ (1eqk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935752Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2935817Protein Phytocystatin [54408] (1 species)
  7. 2935818Species Japanese rice (Oryza sativa), subsp. japonica, oryzacystatin-I [TaxId:4530] [54409] (1 PDB entry)
  8. 2935819Domain d1eqka_: 1eqk A: [37998]

Details for d1eqka_

PDB Entry: 1eqk (more details)

PDB Description: solution structure of oryzacystatin-i, a cysteine proteinase inhibitor of the rice, oryza sativa l. japonica
PDB Compounds: (A:) oryzacystatin-I

SCOPe Domain Sequences for d1eqka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqka_ d.17.1.2 (A:) Phytocystatin {Japanese rice (Oryza sativa), subsp. japonica, oryzacystatin-I [TaxId: 4530]}
mssdggpvlggvepvgnendlhlvdlarfavtehnkkansllefeklvsvkqqvvagtly
yftievkegdakklyeakvwekpwmdfkelqefkpvdasana

SCOPe Domain Coordinates for d1eqka_:

Click to download the PDB-style file with coordinates for d1eqka_.
(The format of our PDB-style files is described here.)

Timeline for d1eqka_: