Lineage for d1eqka_ (1eqk A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 30955Superfamily d.17.1: Cystatin/monellin [54403] (2 families) (S)
  5. 30969Family d.17.1.2: Cystatins [54407] (4 proteins)
  6. 30984Protein Phytocystatin [54408] (1 species)
  7. 30985Species Japanese rice (Oryza sativa), subsp. japonica, oryzacystatin-I [TaxId:4530] [54409] (1 PDB entry)
  8. 30986Domain d1eqka_: 1eqk A: [37998]

Details for d1eqka_

PDB Entry: 1eqk (more details)

PDB Description: solution structure of oryzacystatin-i, a cysteine proteinase inhibitor of the rice, oryza sativa l. japonica

SCOP Domain Sequences for d1eqka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqka_ d.17.1.2 (A:) Phytocystatin {Japanese rice (Oryza sativa), subsp. japonica, oryzacystatin-I}
mssdggpvlggvepvgnendlhlvdlarfavtehnkkansllefeklvsvkqqvvagtly
yftievkegdakklyeakvwekpwmdfkelqefkpvdasana

SCOP Domain Coordinates for d1eqka_:

Click to download the PDB-style file with coordinates for d1eqka_.
(The format of our PDB-style files is described here.)

Timeline for d1eqka_: