Lineage for d1f52l1 (1f52 L:1-100)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131361Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 131362Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 131363Protein Glutamine synthetase, N-terminal domain [54370] (1 species)
  7. 131364Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 131376Domain d1f52l1: 1f52 L:1-100 [37850]
    Other proteins in same PDB: d1f52a2, d1f52b2, d1f52c2, d1f52d2, d1f52e2, d1f52f2, d1f52g2, d1f52h2, d1f52i2, d1f52j2, d1f52k2, d1f52l2

Details for d1f52l1

PDB Entry: 1f52 (more details), 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp

SCOP Domain Sequences for d1f52l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f52l1 d.15.9.1 (L:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d1f52l1:

Click to download the PDB-style file with coordinates for d1f52l1.
(The format of our PDB-style files is described here.)

Timeline for d1f52l1: