SCOPe 2.08: Domain d1pgaa_: 1pga A:

Lineage for d1pgaa_ (1pga A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)

8. Domain d1pgaa_: 1pga A: [37825]

Details for d1pgaa_

PDB Entry: 1pga, 2.07 Å

PDB Description: two crystal structures of the b1 immunoglobulin-binding domain of streptococcal protein g and comparison with nmr

PDB Compounds: (A:) protein g

SCOPe Domain Sequences for d1pgaa_:

Sequence; same for both SEQRES and ATOM records:

>d1pgaa_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

Timeline for d1pgaa_:

• d1pgaa_ first appeared (with stable ids) in SCOP 1.55, called d1pga__
  
• d1pgaa_ appears in SCOPe 2.07