SCOPe 2.08: Domain d6i0ja_: 6i0j A:

Lineage for d6i0ja_ (6i0j A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries)

8. Domain d6i0ja_: 6i0j A: [377010]
   automated match to d3d0na_
   complexed with act, gol, gze, zn

Details for d6i0ja_

PDB Entry: 6i0j, 1.35 Å

PDB Description: crystal structure of human carbonic anhydrase i in complex with the 4- ({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenyl sulfamate inhibitor

PDB Compounds: (A:) Carbonic anhydrase 1

SCOPe Domain Sequences for d6i0ja_:

Sequence; same for both SEQRES and ATOM records:

>d6i0ja_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

Timeline for d6i0ja_:

• d6i0ja_ first appeared in SCOPe 2.07