SCOPe 2.01: Domain d1fxaa_: 1fxa A:

Lineage for d1fxaa_ (1fxa A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (17 species)

7. Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)

8. Domain d1fxaa_: 1fxa A: [37660]
   complexed with fes

Details for d1fxaa_

PDB Entry: 1fxa, 2.5 Å

PDB Description: crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120

PDB Compounds: (A:) [2Fe-2S] ferredoxin

SCOPe Domain Sequences for d1fxaa_:

Sequence; same for both SEQRES and ATOM records:

>d1fxaa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

Timeline for d1fxaa_:

• d1fxaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fxaa_ appears in SCOP 1.75
  
• d1fxaa_ appears in SCOPe 2.02
  
• d1fxaa_ appears in the current release, SCOPe 2.08