PDB entry 1fxa

View 1fxa on RCSB PDB site
Description: crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120
Class: electron transport
Keywords: electron transport
Deposited on 1991-01-09, released 1992-07-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: [2Fe-2S] ferredoxin
    Species: Nostoc sp. [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fxaa_
  • Chain 'B':
    Compound: [2Fe-2S] ferredoxin
    Species: Nostoc sp. [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fxab_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fxaA (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fxaB (B:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly