Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Ralstonia sp. [TaxId:658080] [376582] (1 PDB entry) |
Domain d6qpuf1: 6qpu F:5-163 [376583] automated match to d5tb7a1 complexed with cl, cu, pg4 |
PDB Entry: 6qpu (more details), 2.25 Å
SCOPe Domain Sequences for d6qpuf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qpuf1 b.6.1.0 (F:5-163) automated matches {Ralstonia sp. [TaxId: 658080]} lpgdfgpprgepihavltspplvpppvnrtypakvivelevvekemqisegvsytfwtfg gtvpgsfirvrqgdtvefhlknhpsskmphnidlhgvtgpgggaassftapghesqftfk alnegiyvyhcatapvgmhiangmyglilveppeglpkv
Timeline for d6qpuf1: