SCOPe 2.08: Domain d6qptd1: 6qpt D:6-163

Lineage for d6qptd1 (6qpt D:6-163)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Ralstonia pickettii [TaxId:329] [376570] (1 PDB entry)

8. Domain d6qptd1: 6qpt D:6-163 [376571]
   automated match to d5tb7a1
   complexed with cu, no2, pg4

Details for d6qptd1

PDB Entry: 6qpt, 1.9 Å

PDB Description: crystal structure of nitrite bound synthetic core domain of nitrite reductase from ralstonia pickettii (residues 1-331)

PDB Compounds: (D:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6qptd1:

Sequence; same for both SEQRES and ATOM records:

>d6qptd1 b.6.1.0 (D:6-163) automated matches {Ralstonia pickettii [TaxId: 329]}
pgdfgpprgepihavltspplvpppvnrtypakvivelevvekemqisegvsytfwtfgg
tvpgsfirvrqgdtvefhlknhpsskmphnidlhgvtgpgggaassftapghesqftfka
lnegiyvyhcatapvgmhiangmyglilveppeglpkv

Timeline for d6qptd1:

• d6qptd1 first appeared in SCOPe 2.07