SCOPe 2.07: Domain d6sdkd2: 6sdk D:116-218

Lineage for d6sdkd2 (6sdk D:116-218)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.14: KorB DNA-binding domain-like [109709] (2 families)
   contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix)

5. Family a.4.14.0: automated matches [376125] (1 protein)
   not a true family

6. Protein automated matches [376126] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [376127] (1 PDB entry)

8. Domain d6sdkd2: 6sdk D:116-218 [376132]
   Other proteins in same PDB: d6sdka1, d6sdkb1, d6sdkc1, d6sdkd1
   automated match to d1vz0a1
   complexed with ca, cdp

Details for d6sdkd2

PDB Entry: 6sdk, 1.81 Å

PDB Description: crystal structure of bacterial parb dimer bound to cdp

PDB Compounds: (D:) Stage 0 sporulation protein J

SCOPe Domain Sequences for d6sdkd2:

Sequence; same for both SEQRES and ATOM records:

>d6sdkd2 a.4.14.0 (D:116-218) automated matches {Bacillus subtilis [TaxId: 224308]}
edlspleeaqaydsllkhldltqeqlakrlgksrphianhlrlltlpeniqqliaegtls
mghgrtllglknknkleplvqkviaeqlnvrqleqliqqlnqn

Timeline for d6sdkd2:

• d6sdkd2 is new in SCOPe 2.07-stable
  
• d6sdkd2 appears in the current release, SCOPe 2.08