SCOPe 2.07: Domain d6sdkb1: 6sdk B:20-115

Lineage for d6sdkb1 (6sdk B:20-115)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
   beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)

4. Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families)

5. Family d.268.1.0: automated matches [376121] (1 protein)
   not a true family

6. Protein automated matches [376122] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [376123] (1 PDB entry)

8. Domain d6sdkb1: 6sdk B:20-115 [376129]
   Other proteins in same PDB: d6sdka2, d6sdkb2, d6sdkc2, d6sdkd2
   automated match to d1vz0a2
   complexed with ca, cdp

Details for d6sdkb1

PDB Entry: 6sdk, 1.81 Å

PDB Description: crystal structure of bacterial parb dimer bound to cdp

PDB Compounds: (B:) Stage 0 sporulation protein J

SCOPe Domain Sequences for d6sdkb1:

Sequence; same for both SEQRES and ATOM records:

>d6sdkb1 d.268.1.0 (B:20-115) automated matches {Bacillus subtilis [TaxId: 224308]}
metveeikiadlrpnpyqprkhfddealaelkesvlqhgilqplivrkslkgydivager
rfraaklagldtvpaivrelsealmreiallenlqr

Timeline for d6sdkb1:

• d6sdkb1 is new in SCOPe 2.07-stable
  
• d6sdkb1 appears in the current release, SCOPe 2.08