Lineage for d6sdkd1 (6sdk D:20-115)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615108Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. 2615109Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) (S)
  5. 2615158Family d.268.1.0: automated matches [376121] (1 protein)
    not a true family
  6. 2615159Protein automated matches [376122] (3 species)
    not a true protein
  7. 2615160Species Bacillus subtilis [TaxId:224308] [376123] (1 PDB entry)
  8. 2615164Domain d6sdkd1: 6sdk D:20-115 [376131]
    Other proteins in same PDB: d6sdka2, d6sdkb2, d6sdkc2, d6sdkd2
    automated match to d1vz0a2
    complexed with ca, cdp

Details for d6sdkd1

PDB Entry: 6sdk (more details), 1.81 Å

PDB Description: crystal structure of bacterial parb dimer bound to cdp
PDB Compounds: (D:) Stage 0 sporulation protein J

SCOPe Domain Sequences for d6sdkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sdkd1 d.268.1.0 (D:20-115) automated matches {Bacillus subtilis [TaxId: 224308]}
metveeikiadlrpnpyqprkhfddealaelkesvlqhgilqplivrkslkgydivager
rfraaklagldtvpaivrelsealmreiallenlqr

SCOPe Domain Coordinates for d6sdkd1:

Click to download the PDB-style file with coordinates for d6sdkd1.
(The format of our PDB-style files is described here.)

Timeline for d6sdkd1: