Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily) beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8) |
Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) |
Family d.268.1.0: automated matches [376121] (1 protein) not a true family |
Protein automated matches [376122] (3 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [376123] (1 PDB entry) |
Domain d6sdkd1: 6sdk D:20-115 [376131] Other proteins in same PDB: d6sdka2, d6sdkb2, d6sdkc2, d6sdkd2 automated match to d1vz0a2 complexed with ca, cdp |
PDB Entry: 6sdk (more details), 1.81 Å
SCOPe Domain Sequences for d6sdkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sdkd1 d.268.1.0 (D:20-115) automated matches {Bacillus subtilis [TaxId: 224308]} metveeikiadlrpnpyqprkhfddealaelkesvlqhgilqplivrkslkgydivager rfraaklagldtvpaivrelsealmreiallenlqr
Timeline for d6sdkd1: