Lineage for d1bknb1 (1bkn B:617-731)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130799Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 130800Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 130841Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (3 proteins)
  6. 130846Protein DNA mismatch repair protein MutL [54225] (1 species)
  7. 130847Species Escherichia coli [TaxId:562] [54226] (3 PDB entries)
  8. 130851Domain d1bknb1: 1bkn B:617-731 [37569]
    Other proteins in same PDB: d1bkna2, d1bknb2

Details for d1bknb1

PDB Entry: 1bkn (more details), 2.9 Å

PDB Description: crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl

SCOP Domain Sequences for d1bknb1:

Sequence, based on SEQRES records: (download)

>d1bknb1 d.14.1.3 (B:617-731) DNA mismatch repair protein MutL {Escherichia coli}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

Sequence, based on observed residues (ATOM records): (download)

>d1bknb1 d.14.1.3 (B:617-731) DNA mismatch repair protein MutL {Escherichia coli}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvhqsrlvhdfiyqgvlsvlq

SCOP Domain Coordinates for d1bknb1:

Click to download the PDB-style file with coordinates for d1bknb1.
(The format of our PDB-style files is described here.)

Timeline for d1bknb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bknb2