SCOPe 2.08: Domain d6jlmt_: 6jlm t:

Lineage for d6jlmt_ (6jlm t:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family)
   automatically mapped to Pfam PF01405

5. Family f.23.34.1: PsbT-like [161030] (2 proteins)
   Pfam PF01405

6. Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries)

8. Domain d6jlmt_: 6jlm t: [375558]
   Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlmk_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_
   automated match to d3bz2t_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlmt_

PDB Entry: 6jlm, 2.35 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset2)

PDB Compounds: (t:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d6jlmt_:

Sequence; same for both SEQRES and ATOM records:

>d6jlmt_ f.23.34.1 (t:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

Timeline for d6jlmt_:

• d6jlmt_ first appeared in SCOPe 2.07