SCOPe 2.08: Domain d6jlmj_: 6jlm J:

Lineage for d6jlmj_ (6jlm J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families)
   automatically mapped to Pfam PF01788

5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
   Pfam PF01788

6. Protein automated matches [191002] (3 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries)

8. Domain d6jlmj_: 6jlm J: [375515]
   Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmk_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_
   automated match to d5ws5j_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlmj_

PDB Entry: 6jlm, 2.35 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset2)

PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d6jlmj_:

Sequence; same for both SEQRES and ATOM records:

>d6jlmj_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
seggriplwivatvagmgvivivglffygayaglgssl

Timeline for d6jlmj_:

• d6jlmj_ first appeared in SCOPe 2.07