![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) ![]() automatically mapped to Pfam PF01788 |
![]() | Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
![]() | Protein automated matches [191002] (3 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries) |
![]() | Domain d6jlmj_: 6jlm J: [375515] Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmk_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_ automated match to d5ws5j_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlm (more details), 2.35 Å
SCOPe Domain Sequences for d6jlmj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlmj_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} seggriplwivatvagmgvivivglffygayaglgssl
Timeline for d6jlmj_: