SCOPe 2.07: Domain d6jlnh_: 6jln H:

Lineage for d6jlnh_ (6jln H:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)

8. Domain d6jlnh_: 6jln H: [375448]
   Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnx_, d6jlnz_
   automated match to d5v2ch_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlnh_

PDB Entry: 6jln, 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset2)

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d6jlnh_:

Sequence; same for both SEQRES and ATOM records:

>d6jlnh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

Timeline for d6jlnh_:

• d6jlnh_ is new in SCOPe 2.07-stable
  
• d6jlnh_ appears in the current release, SCOPe 2.08