Lineage for d6jlnd_ (6jln d:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632815Protein automated matches [190224] (14 species)
    not a true protein
  7. 2632944Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (26 PDB entries)
  8. 2632981Domain d6jlnd_: 6jln d: [375438]
    Other proteins in same PDB: d6jlnb_, d6jlnc_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnx_, d6jlnz_
    automated match to d5zznd_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlnd_

PDB Entry: 6jln (more details), 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset2)
PDB Compounds: (d:) Photosystem II D2 protein

SCOPe Domain Sequences for d6jlnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlnd_ f.26.1.1 (d:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d6jlnd_:

Click to download the PDB-style file with coordinates for d6jlnd_.
(The format of our PDB-style files is described here.)

Timeline for d6jlnd_: