![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
![]() | Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
![]() | Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries) |
![]() | Domain d6jlnm_: 6jln M: [375446] Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnx_, d6jlnz_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jln (more details), 2.4 Å
SCOPe Domain Sequences for d6jlnm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlnm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]} mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d6jlnm_: