Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries) |
Domain d6rzqa2: 6rzq A:219-417 [375204] automated match to d3fe1a2 complexed with anp, gol, mg |
PDB Entry: 6rzq (more details), 1.81 Å
SCOPe Domain Sequences for d6rzqa2:
Sequence, based on SEQRES records: (download)
>d6rzqa2 c.55.1.0 (A:219-417) automated matches {Plasmodium falciparum [TaxId: 36329]} gkgeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkk nggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcm dqfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpde avaygaavqaailsgdqss
>d6rzqa2 c.55.1.0 (A:219-417) automated matches {Plasmodium falciparum [TaxId: 36329]} ggeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkkn ggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcmd qfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpdea vaygaavqaailsgdqss
Timeline for d6rzqa2: