Lineage for d6rzqa2 (6rzq A:219-417)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493223Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)
  8. 2493243Domain d6rzqa2: 6rzq A:219-417 [375204]
    automated match to d3fe1a2
    complexed with anp, gol, mg

Details for d6rzqa2

PDB Entry: 6rzq (more details), 1.81 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain - anp-pnp bound state
PDB Compounds: (A:) Heat shock protein 70

SCOPe Domain Sequences for d6rzqa2:

Sequence, based on SEQRES records: (download)

>d6rzqa2 c.55.1.0 (A:219-417) automated matches {Plasmodium falciparum [TaxId: 36329]}
gkgeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkk
nggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcm
dqfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpde
avaygaavqaailsgdqss

Sequence, based on observed residues (ATOM records): (download)

>d6rzqa2 c.55.1.0 (A:219-417) automated matches {Plasmodium falciparum [TaxId: 36329]}
ggeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkkn
ggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcmd
qfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpdea
vaygaavqaailsgdqss

SCOPe Domain Coordinates for d6rzqa2:

Click to download the PDB-style file with coordinates for d6rzqa2.
(The format of our PDB-style files is described here.)

Timeline for d6rzqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6rzqa1