SCOPe 2.07: Domain d6rzqa1: 6rzq A:33-215

Lineage for d6rzqa1 (6rzq A:33-215)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)

8. Domain d6rzqa1: 6rzq A:33-215 [375203]
   automated match to d3fe1a1
   complexed with anp, gol, mg

Details for d6rzqa1

PDB Entry: 6rzq, 1.81 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain - anp-pnp bound state

PDB Compounds: (A:) Heat shock protein 70

SCOPe Domain Sequences for d6rzqa1:

Sequence; same for both SEQRES and ATOM records:

>d6rzqa1 c.55.1.0 (A:33-215) automated matches {Plasmodium falciparum [TaxId: 36329]}
evaigidlgttyscvgicrngvvdiiandqgnrttpsyvaftdterligdaaknqasrnp
entvfdakrligrkfsettvqsdmkhwpftvkggsdgkpmievsyqgekktfhpeeissm
vlkkmkevaetylgkpvknavitvpayfndsqrqatkdagaiaglnvlriineptaaaia
ygl

Timeline for d6rzqa1:

• d6rzqa1 is new in SCOPe 2.07-stable
  
• d6rzqa1 appears in the current release, SCOPe 2.08