Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries) |
Domain d3fe1a2: 3fe1 A:191-385 [209871] Other proteins in same PDB: d3fe1a3, d3fe1b3 automated match to d1ngfa2 complexed with adp, cl, mg, pge, po4 |
PDB Entry: 3fe1 (more details), 2.2 Å
SCOPe Domain Sequences for d3fe1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fe1a2 c.55.1.0 (A:191-385) automated matches {Human (Homo sapiens) [TaxId: 9606]} gagernvlifdlgggtfdvsvlsidagvfevkatagdthlggedfdnrlvnhfmeefrrk hgkdlsgnkralrrlrtacerakrtlssstqatleidslfegvdfytsitrarfeelcsd lfrstlepvekalrdakldkaqihdvvlvggstripkvqkllqdffngkelnksinpdea vaygaavqaavlmgd
Timeline for d3fe1a2: